Recombinant Human RTKN2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RTKN2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 163 of Human RTKN2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENVTIL

Protein/Peptide Type
Recombinant Protein
Gene
RTKN2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RTKN2 Protein

  • bA531F24.1
  • DKFZp686J10120
  • Em:AC024597.2
  • FLJ39352
  • PH domain-containing family K member 1
  • pleckstrin homology domain containing, family K member 1
  • Pleckstrin homology domain-containing family K member 1
  • PLEKHK1
  • rhotekin 2
  • rhotekin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-88956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4300
Species: Hu
Applications: IHC
H00219790-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for RTKN2 Recombinant Protein (H00219790-P02) (0)

There are no publications for RTKN2 Recombinant Protein (H00219790-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTKN2 Recombinant Protein (H00219790-P02) (0)

There are no reviews for RTKN2 Recombinant Protein (H00219790-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RTKN2 Recombinant Protein (H00219790-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RTKN2 Products

Bioinformatics Tool for RTKN2 Recombinant Protein (H00219790-P02)

Discover related pathways, diseases and genes to RTKN2 Recombinant Protein (H00219790-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTKN2 Recombinant Protein (H00219790-P02)

Discover more about diseases related to RTKN2 Recombinant Protein (H00219790-P02).
 

Pathways for RTKN2 Recombinant Protein (H00219790-P02)

View related products by pathway.

Blogs on RTKN2

There are no specific blogs for RTKN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371
RTKN2 Antibody
H00219790-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RTKN2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RTKN2