RNFT2 Antibody


Western Blot: RNFT2 Antibody [NBP2-32383] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RNFT2 Antibody [NBP2-32383] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RNFT2 Antibody [NBP2-32383] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: RNFT2 Antibody [NBP2-32383] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: RNFT2 Antibody [NBP2-32383] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: RNFT2 Antibody [NBP2-32383] - Staining in human cerebral cortex and liver tissues using anti-RNFT2 antibody. Corresponding RNFT2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RNFT2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QPHHHFHHGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLP
Specificity of human RNFT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNFT2 Protein (NBP2-32383PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RNFT2 Antibody

  • FLJ14627
  • RING finger and transmembrane domain-containing protein 2
  • ring finger protein, transmembrane 2
  • TMEM118
  • transmembrane protein 118


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNFT2 Antibody (NBP2-32383) (0)

There are no publications for RNFT2 Antibody (NBP2-32383).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNFT2 Antibody (NBP2-32383) (0)

There are no reviews for RNFT2 Antibody (NBP2-32383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNFT2 Antibody (NBP2-32383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RNFT2 Products

Bioinformatics Tool for RNFT2 Antibody (NBP2-32383)

Discover related pathways, diseases and genes to RNFT2 Antibody (NBP2-32383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RNFT2 Antibody (NBP2-32383)

Find related products by research area.

Blogs on RNFT2

There are no specific blogs for RNFT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNFT2 Antibody and receive a gift card or discount.


Gene Symbol RNFT2