RNF181 Antibody (5A7) - Azide and BSA Free

Western Blot: RNF181 Antibody (5A7) [H00051255-M01] - RNF181 monoclonal antibody (M01), clone 5A7 Analysis of RNF181 expression in Jurkat.

Western Blot: RNF181 Antibody (5A7) [H00051255-M01] - Analysis of RNF181 expression in transfected 293T cell line by RNF181 monoclonal antibody (M01), clone 5A7.Lane 1: RNF181 transfected lysate(17.9 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: RNF181 Antibody (5A7) [H00051255-M01] - Analysis of RNF181 transfected lysate using anti-RNF181 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF181 monoclonal antibody.

Sandwich ELISA: RNF181 Antibody (5A7) [H00051255-M01] - Detection limit for recombinant GST tagged RNF181 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 5A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF181 Antibody (5A7) - Azide and BSA Free Summary

• Immunogen: RNF181 (NP_057578, 90 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
• Specificity: LOC51255 - hypothetical protein LOC51255
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RNF181
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF181 Antibody (5A7) - Azide and BSA Free

• E3 ubiquitin-protein ligase RNF181
• EC 6.3.2.-
• ring finger protein 181HSPC238

Background

RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF181
• Entrez:
  • 51255(Human)
• Uniprot:
  • NP_057578(Human)