RNF148 Antibody

Images

 
Western Blot: RNF148 Antibody [NBP1-59516] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF148 Antibody Summary

Immunogen
Synthetic peptides corresponding to RNF148(ring finger protein 148) The peptide sequence was selected from the C terminal of RNF148 (NP_932351). Peptide sequence PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKP. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF148
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RNF148 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-59516.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF148 Antibody

  • MGC35222
  • ring finger protein 148

Background

RNF148 is a single-pass membrane protein. It contains 1 PA (protease associated) domain and 1 RING-type zinc finger. The exact function of RNF148 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF148 Antibody (NBP1-59516)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-59516 Applications Species
Saurin, AJ et al. Does this have a familiar RING?. Trends Biochem. Sci. 21 (6), 208-214. 1996 [PMID: 8744354]

Reviews for RNF148 Antibody (NBP1-59516) (0)

There are no reviews for RNF148 Antibody (NBP1-59516). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF148 Antibody (NBP1-59516) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF148 Products

Bioinformatics Tool for RNF148 Antibody (NBP1-59516)

Discover related pathways, diseases and genes to RNF148 Antibody (NBP1-59516). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RNF148 Antibody (NBP1-59516)

Find related products by research area.

Blogs on RNF148

There are no specific blogs for RNF148, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF148 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF148
Entrez
Uniprot