RGS19 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related RGS19 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-56027PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RGS19 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RGS19.

Source: E. coli

Amino Acid Sequence: PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RGS19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56027.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RGS19 Recombinant Protein Antigen

  • G alpha interacting protein
  • GAIPG protein signalling regulator 19
  • G-alpha-interacting protein
  • GNAI3IP
  • guanine nucleotide binding protein alpha inhibiting activity polypeptide 3interacting protein
  • regulator of G-protein signaling 19
  • regulator of G-protein signalling 19
  • RGSGAIP

Background

G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.; FUNCTION: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G-alpha subfamily 1 members, with the order G(i)a3 > G(i)a1 > G(o)a >> G(z)a/G(i)a2. Activity on G(z)-alpha is inhibited by phosphorylation and palmitoylation of the G-protein. SUBCELLULAR LOCATION: Membrane; Lipid-anchor. TISSUE SPECIFICITY: Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91941
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00008601-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00005997-M01
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, KD, WB
NB100-1029
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-47255
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP1-86020
Species: Hu
Applications: IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-01584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
NBP1-91968
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP2-56027PEP
Species: Hu
Applications: AC

Publications for RGS19 Recombinant Protein Antigen (NBP2-56027PEP) (0)

There are no publications for RGS19 Recombinant Protein Antigen (NBP2-56027PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS19 Recombinant Protein Antigen (NBP2-56027PEP) (0)

There are no reviews for RGS19 Recombinant Protein Antigen (NBP2-56027PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RGS19 Recombinant Protein Antigen (NBP2-56027PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RGS19 Products

Research Areas for RGS19 Recombinant Protein Antigen (NBP2-56027PEP)

Find related products by research area.

Blogs on RGS19

There are no specific blogs for RGS19, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RGS19 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS19