RGS19 Antibody

Product Discontinued

RGS19 Antibody Summary

• Immunogen: Synthetic peptides corresponding to RGS19(regulator of G-protein signaling 19) The peptide sequence was selected from the N terminal of RGS19. Peptide sequence PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW.
• Predicted Species: Mouse (93%), Rat (93%), Equine (93%), Bovine (92%), Guinea Pig (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RGS19
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against RGS19 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RGS19 Antibody

• G alpha interacting protein
• GAIPG protein signalling regulator 19
• G-alpha-interacting protein
• GNAI3IP
• guanine nucleotide binding protein alpha inhibiting activity polypeptide 3interacting protein
• regulator of G-protein signaling 19
• regulator of G-protein signalling 19
• RGSGAIP

Background

G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RGS19
• Uniprot:
  • P49795(Human)