RGS19 Antibody


Western Blot: RGS19 Antibody [NBP1-58347] - Human Lung lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: RGS19 Antibody [NBP1-58347] - Tissue: Human bronchiole epithelium.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RGS19 Antibody Summary

Synthetic peptides corresponding to RGS19(regulator of G-protein signaling 19) The peptide sequence was selected from the N terminal of RGS19. Peptide sequence PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
Application Notes
This is a rabbit polyclonal antibody against RGS19 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RGS19 Antibody

  • G alpha interacting protein
  • GAIPG protein signalling regulator 19
  • G-alpha-interacting protein
  • guanine nucleotide binding protein alpha inhibiting activity polypeptide 3interacting protein
  • regulator of G-protein signaling 19
  • regulator of G-protein signalling 19


G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mk
Applications: IHC-P, ICC
Species: Hu
Applications: IHC-P
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RGS19 Antibody (NBP1-58347) (0)

There are no publications for RGS19 Antibody (NBP1-58347).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS19 Antibody (NBP1-58347) (0)

There are no reviews for RGS19 Antibody (NBP1-58347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS19 Antibody (NBP1-58347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RGS19 Products

Bioinformatics Tool for RGS19 Antibody (NBP1-58347)

Discover related pathways, diseases and genes to RGS19 Antibody (NBP1-58347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS19 Antibody (NBP1-58347)

Discover more about diseases related to RGS19 Antibody (NBP1-58347).

Pathways for RGS19 Antibody (NBP1-58347)

View related products by pathway.

PTMs for RGS19 Antibody (NBP1-58347)

Learn more about PTMs related to RGS19 Antibody (NBP1-58347).

Research Areas for RGS19 Antibody (NBP1-58347)

Find related products by research area.

Blogs on RGS19

There are no specific blogs for RGS19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RGS19 Antibody and receive a gift card or discount.


Gene Symbol RGS19