RFPL4B Antibody

Images

 
Western Blot: RFPL4B Antibody [NBP1-55032] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFPL4B Antibody Summary

Immunogen
Synthetic peptides corresponding to RFPL4B(ret finger protein-like 4B) The peptide sequence was selected from the middle region of RFPL4B. Peptide sequence EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIHANTHLERIPA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFPL4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RFPL4B and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RFPL4B Antibody

  • ret finger protein-like 4B
  • RNF211RING finger protein 211

Background

RFPL4B contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of RFPL4B remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RFPL4B Antibody (NBP1-55032) (0)

There are no publications for RFPL4B Antibody (NBP1-55032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFPL4B Antibody (NBP1-55032) (0)

There are no reviews for RFPL4B Antibody (NBP1-55032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFPL4B Antibody (NBP1-55032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFPL4B Products

Bioinformatics Tool for RFPL4B Antibody (NBP1-55032)

Discover related pathways, diseases and genes to RFPL4B Antibody (NBP1-55032). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RFPL4B Antibody (NBP1-55032)

Find related products by research area.

Blogs on RFPL4B

There are no specific blogs for RFPL4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFPL4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFPL4B
Uniprot