New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

PWWP2A Antibody


Western Blot: PWWP2A Antibody [NBP1-70642] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PWWP2A Antibody Summary

Synthetic peptides corresponding to PWWP2A(PWWP domain containing 2A) The peptide sequence was selected from the C terminal of PWWP2A. Peptide sequence PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PWWP2A and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PWWP2A Antibody

  • KIAA1935
  • MST101
  • MSTP101
  • PWWP domain containing 2A
  • PWWP domain-containing protein 2A


PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PWWP2A Antibody (NBP1-70642) (0)

There are no publications for PWWP2A Antibody (NBP1-70642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PWWP2A Antibody (NBP1-70642) (0)

There are no reviews for PWWP2A Antibody (NBP1-70642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PWWP2A Antibody (NBP1-70642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PWWP2A Products

Bioinformatics Tool for PWWP2A Antibody (NBP1-70642)

Discover related pathways, diseases and genes to PWWP2A Antibody (NBP1-70642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PWWP2A

There are no specific blogs for PWWP2A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PWWP2A Antibody and receive a gift card or discount.


Gene Symbol PWWP2A