PWWP2A Antibody


Western Blot: PWWP2A Antibody [NBP1-70642] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

PWWP2A Antibody Summary

Synthetic peptides corresponding to PWWP2A(PWWP domain containing 2A) The peptide sequence was selected from the C terminal of PWWP2A. Peptide sequence PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PWWP2A and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PWWP2A Antibody

  • KIAA1935
  • MST101
  • MSTP101
  • PWWP domain containing 2A
  • PWWP domain-containing protein 2A


PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PWWP2A Antibody (NBP1-70642) (0)

There are no publications for PWWP2A Antibody (NBP1-70642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PWWP2A Antibody (NBP1-70642) (0)

There are no reviews for PWWP2A Antibody (NBP1-70642). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PWWP2A Antibody (NBP1-70642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PWWP2A Antibody Products

PWWP2A NBP1-70642

Bioinformatics Tool for PWWP2A Antibody (NBP1-70642)

Discover related pathways, diseases and genes to PWWP2A Antibody (NBP1-70642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PWWP2A

There are no specific blogs for PWWP2A, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol PWWP2A

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-70642 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought