PRAMEF10 Antibody

Western Blot: PRAMEF10 Antibody [NBP1-56432] - Human Brain lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PRAMEF10 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PRAMEF10(PRAME family member 10) The peptide sequence was selected from the middle region of PRAMEF10. Peptide sequence DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRAMEF10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PRAMEF10 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRAMEF10 Antibody

• MGC138413
• MGC138415
• PRAME family member 10
• RP5-845O24.7

Background

PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRAMEF10
• Uniprot:
  • O60809(Human)