Recombinant Human PRADC1/PAP21 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRADC1/PAP21 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-188 of Human C2orf7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PRADC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRADC1/PAP21 Protein

  • chromosome 2 open reading frame 7
  • hPAP21
  • MGC13004
  • PAP21
  • protease-associated domain-containing glycoprotein 21 kDa
  • protease-associated domain-containing protein of 21 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-31569
Species: Hu
Applications: IHC, IHC-P
NBP1-82279
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83792
Species: Hu
Applications: IHC, IHC-P

Publications for PRADC1/PAP21 Recombinant Protein (H00084279-P01) (0)

There are no publications for PRADC1/PAP21 Recombinant Protein (H00084279-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRADC1/PAP21 Recombinant Protein (H00084279-P01) (0)

There are no reviews for PRADC1/PAP21 Recombinant Protein (H00084279-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRADC1/PAP21 Recombinant Protein (H00084279-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRADC1/PAP21 Products

Bioinformatics Tool for PRADC1/PAP21 Recombinant Protein (H00084279-P01)

Discover related pathways, diseases and genes to PRADC1/PAP21 Recombinant Protein (H00084279-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRADC1/PAP21 Recombinant Protein (H00084279-P01)

Discover more about diseases related to PRADC1/PAP21 Recombinant Protein (H00084279-P01).
 

Pathways for PRADC1/PAP21 Recombinant Protein (H00084279-P01)

View related products by pathway.

PTMs for PRADC1/PAP21 Recombinant Protein (H00084279-P01)

Learn more about PTMs related to PRADC1/PAP21 Recombinant Protein (H00084279-P01).

Blogs on PRADC1/PAP21

There are no specific blogs for PRADC1/PAP21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
MANEA Antibody
NBP1-82279

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRADC1/PAP21 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRADC1