Recombinant Human PPPDE2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related PPPDE2 Peptides and Proteins

Order Details


    • Catalog Number
      H00027351-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human PPPDE2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-168 of Human D15Wsu75e full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DESI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
44.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPPDE2 Protein

  • D15Wsu75e
  • DJ347H13.4
  • FAM152B
  • family with sequence similarity 152, member B
  • MGC138384
  • PPPDE peptidase domain containing 2
  • PPPDE peptidase domain-containing protein 2
  • Protein FAM152B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
NBP1-88506
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB2959
Species: Hu
Applications: ICC
NBP2-32901
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for PPPDE2 Recombinant Protein (H00027351-P01) (0)

There are no publications for PPPDE2 Recombinant Protein (H00027351-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPPDE2 Recombinant Protein (H00027351-P01) (0)

There are no reviews for PPPDE2 Recombinant Protein (H00027351-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPPDE2 Recombinant Protein (H00027351-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPPDE2 Products

Blogs on PPPDE2

There are no specific blogs for PPPDE2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPPDE2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DESI1