PM20D2 Antibody

Western Blot: PM20D2 Antibody [NBP1-70678] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PM20D2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PM20D2(peptidase M20 domain containing 2) The peptide sequence was selected from the middle region of PM20D2. Peptide sequence HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PM20D2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PM20D2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PM20D2 Antibody

• aminoacylase-1-like protein 2
• bA63L7.3
• peptidase M20 domain containing 2
• peptidase M20 domain-containing protein 2

Background

PM20D2 belongs to the peptidase M20A family. The function of PM20D2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PM20D2