PIGS Antibody

Images

 
Western Blot: PIGS Antibody [NBP1-74155] - Mouse Small Intestine Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGS Antibody Summary

Immunogen
Synthetic peptides corresponding to thesis class S Antibody against the C terminal of Pigs. Immunizing peptide sequence AVAAVQKAAKALALGHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Pigs and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PIGS Antibody

  • DKFZp686K20216
  • FLJ45226
  • GPI transamidase component PIG-S
  • GPI transamidase subunit
  • phosphatidylinositol glycan anchor biosynthesis, class S
  • phosphatidylinositol glycan, class S
  • Phosphatidylinositol-glycan biosynthesis class S protein

Background

Pigs is a component of the GPI transamidase complex. It is essential for transfer of GPI to proteins, particularly for formation of carbonyl intermediates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIGS Antibody (NBP1-74155) (0)

There are no publications for PIGS Antibody (NBP1-74155).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGS Antibody (NBP1-74155) (0)

There are no reviews for PIGS Antibody (NBP1-74155). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGS Antibody (NBP1-74155) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PIGS Products

Array NBP1-74155

Bioinformatics Tool for PIGS Antibody (NBP1-74155)

Discover related pathways, diseases and genes to PIGS Antibody (NBP1-74155). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PIGS Antibody (NBP1-74155)

View related products by pathway.

Blogs on PIGS

There are no specific blogs for PIGS, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGS
Uniprot
Novus 100% Guarantee