![Western Blot: PHYHD1 Antibody [H00254295-B01P] - Analysis of PHYHD1 expression in human liver.](http://images.novusbio.com/fullsize/PHYHD1-Antibody-Western-Blot-H00254295-B01P-img0003.jpg "Western Blot: PHYHD1 Antibody [H00254295-B01P] - Analysis of PHYHD1 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | PHYHD1 (NP_777593.1, 1 a.a. - 297 a.a.) full-length human protein. MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKSPLIRTPPSCTRSPWAGCWACGSQWRMPRWRTAVSGSSLAPTPVVCQGGWSGPLLAQRLVPASLGQSQPGITASLCPPQCREGPWSSSMEKWYTRASRTSLTARARPTLSTSWRPLAPPGARRTGSSQQLNCPFPNCTPKGSRRAGALAPPG |
| Specificity | Reacts with phytanoyl-CoA dioxygenase domain containing 1. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PHYHD1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PHYHD1 Antibody (H00254295-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PHYHD1 |
| Entrez |
|
| Uniprot |
|
![Western Blot: PHYHD1 Antibody [H00254295-B01P] - Analysis of PHYHD1 expression in transfected 293T cell line by PHYHD1 polyclonal antibody. Lane 1: PHYHD1 transfected lysate(32.67 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PHYHD1-Antibody-Western-Blot-H00254295-B01P-img0004.jpg "Western Blot: PHYHD1 Antibody [H00254295-B01P] - Analysis of PHYHD1 expression in transfected 293T cell line by PHYHD1 polyclonal antibody. Lane 1: PHYHD1 transfected lysate(32.67 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")