![Immunocytochemistry/Immunofluorescence: PDZD8 Antibody [NBP2-58671] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & plasma membrane.](http://images.novusbio.com/fullsize/PDZD8-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58671-img0001.jpg "Immunocytochemistry/Immunofluorescence: PDZD8 Antibody [NBP2-58671] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & plasma membrane.")
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDR |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDZD8 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PDZD8 Antibody (NBP2-58671)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDZD8 |
