PCDHGA4 Antibody


Western Blot: PCDHGA4 Antibody [NBP1-59234] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PCDHGA4 Antibody Summary

Synthetic peptides corresponding to PCDHGA4(protocadherin gamma subfamily A, 4) The peptide sequence was selected from the N terminal of PCDHGA4. Peptide sequence GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCDHGA4 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCDHGA4 Antibody

  • protocadherin gamma subfamily A, 4
  • protocadherin gamma-A4


PCDHGA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCDHGA4 Antibody (NBP1-59234) (0)

There are no publications for PCDHGA4 Antibody (NBP1-59234).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHGA4 Antibody (NBP1-59234) (0)

There are no reviews for PCDHGA4 Antibody (NBP1-59234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHGA4 Antibody (NBP1-59234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCDHGA4 Products

PCDHGA4 NBP1-59234

Bioinformatics Tool for PCDHGA4 Antibody (NBP1-59234)

Discover related pathways, diseases and genes to PCDHGA4 Antibody (NBP1-59234). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PCDHGA4

There are no specific blogs for PCDHGA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought


Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCDHGA4 Antibody and receive a gift card or discount.


Gene Symbol PCDHGA4