PCDHA12 Antibody

Images

 
Western Blot: PCDHA12 Antibody [NBP1-59252] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCDHA12 Antibody Summary

Immunogen
Synthetic peptides corresponding to PCDHA12(protocadherin alpha 12) The peptide sequence was selected from the N terminal of PCDHA12. Peptide sequence EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDHA12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCDHA12 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCDHA12 Antibody

  • KIAA0345-like 2
  • MGC138485
  • MGC141932
  • PCDH-ALPHA12
  • PCDH-alpha-12
  • protocadherin alpha 12
  • protocadherin alpha-12

Background

PCDHA12 is a potential calcium-dependent cell-adhesion protein. PCDHA12 may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCDHA12 Antibody (NBP1-59252) (0)

There are no publications for PCDHA12 Antibody (NBP1-59252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHA12 Antibody (NBP1-59252) (0)

There are no reviews for PCDHA12 Antibody (NBP1-59252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHA12 Antibody (NBP1-59252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCDHA12 Products

Bioinformatics Tool for PCDHA12 Antibody (NBP1-59252)

Discover related pathways, diseases and genes to PCDHA12 Antibody (NBP1-59252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PCDHA12

There are no specific blogs for PCDHA12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCDHA12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHA12
Uniprot