PCDHA12 Antibody


Western Blot: PCDHA12 Antibody [NBP1-59252] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

PCDHA12 Antibody Summary

Synthetic peptides corresponding to PCDHA12(protocadherin alpha 12) The peptide sequence was selected from the N terminal of PCDHA12. Peptide sequence EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against PCDHA12 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCDHA12 Antibody

  • KIAA0345-like 2
  • MGC138485
  • MGC141932
  • PCDH-alpha-12
  • protocadherin alpha 12
  • protocadherin alpha-12


PCDHA12 is a potential calcium-dependent cell-adhesion protein. PCDHA12 may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCDHA12 Antibody (NBP1-59252) (0)

There are no publications for PCDHA12 Antibody (NBP1-59252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHA12 Antibody (NBP1-59252) (0)

There are no reviews for PCDHA12 Antibody (NBP1-59252). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHA12 Antibody (NBP1-59252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCDHA12 Antibody Products

Bioinformatics Tool for PCDHA12 Antibody (NBP1-59252)

Discover related pathways, diseases and genes to PCDHA12 Antibody (NBP1-59252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PCDHA12

There are no specific blogs for PCDHA12, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol PCDHA12

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59252 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought