PCBP3 Recombinant Protein Antigen

Images

 
There are currently no images for PCBP3 Protein (NBP1-89505PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PCBP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCBP3.

Source: E.coli

Amino Acid Sequence: TIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PCBP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89505.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PCBP3 Recombinant Protein Antigen

  • Alpha-CP3
  • poly (rC)-binding protein 310ALPHA-CP3
  • poly(rC) binding protein 3
  • poly(rC)-binding protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
H00004438-Q01
Species: Hu
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1620
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCBP3 Protein (NBP1-89505PEP) (0)

There are no publications for PCBP3 Protein (NBP1-89505PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCBP3 Protein (NBP1-89505PEP) (0)

There are no reviews for PCBP3 Protein (NBP1-89505PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PCBP3 Protein (NBP1-89505PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PCBP3 Protein (NBP1-89505PEP)

Discover related pathways, diseases and genes to PCBP3 Protein (NBP1-89505PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCBP3 Protein (NBP1-89505PEP)

Discover more about diseases related to PCBP3 Protein (NBP1-89505PEP).
 

Pathways for PCBP3 Protein (NBP1-89505PEP)

View related products by pathway.

Blogs on PCBP3

There are no specific blogs for PCBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PCBP3 Antibody
NBP1-89505

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PCBP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PCBP3