![Western Blot: PAXX Antibody [NBP1-94172] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-C9orf142 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/PAXX-Antibody-Western-Blot-NBP1-94172-img0009.jpg "Western Blot: PAXX Antibody [NBP1-94172] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-C9orf142 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PAXX |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PAXX |
![Immunocytochemistry/Immunofluorescence: PAXX Antibody [NBP1-94172] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/PAXX-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-94172-img0008.jpg "Immunocytochemistry/Immunofluorescence: PAXX Antibody [NBP1-94172] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/PAXX-Antibody-Immunohistochemistry-Paraffin-NBP1-94172-img0011.jpg "Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/PAXX-Antibody-Immunohistochemistry-Paraffin-NBP1-94172-img0002.jpg "Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human prostate shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PAXX-Antibody-Immunohistochemistry-Paraffin-NBP1-94172-img0010.jpg "Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human prostate shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human stomach shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PAXX-Antibody-Immunohistochemistry-Paraffin-NBP1-94172-img0012.jpg "Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human stomach shows strong nuclear positivity in glandular cells.")
![Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx-/- mice. Western blot analyses using Novus anti-PAXX immunoglobulins revealed the lack of PAXX protein in Paxx-/- tail fibroblasts, spleen, thymus, liver, and lungs when compared to Paxx+/+ controls and reduction of PAXX protein in Paxx+/- cells.](http://images.novusbio.com/fullsize/PAXX-Antibody-Knockout-Validated-NBP1-94172-img0013.jpg "Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx-/- mice. Western blot analyses using Novus anti-PAXX immunoglobulins revealed the lack of PAXX protein in Paxx-/- tail fibroblasts, spleen, thymus, liver, and lungs when compared to Paxx+/+ controls and reduction of PAXX protein in Paxx+/- cells.")
![Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx-/- mice. Western blot analyses using Novus anti-PAXX immunoglobulins revealed the lack of PAXX protein in Paxx-/- tail fibroblasts, spleen, thymus when compared to Paxx+/+ controls and reduction of PAXX protein in Paxx+/- cells. Image collected and cropped by CiteAb from the following publication (//febs.onlinelibrary.wiley.com/doi/full/10.1002/2211-5463.12381), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/PAXX-Antibody-Knockout-Validated-NBP1-94172-img0014.jpg "Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx-/- mice. Western blot analyses using Novus anti-PAXX immunoglobulins revealed the lack of PAXX protein in Paxx-/- tail fibroblasts, spleen, thymus when compared to Paxx+/+ controls and reduction of PAXX protein in Paxx+/- cells. Image collected and cropped by CiteAb from the following publication (//febs.onlinelibrary.wiley.com/doi/full/10.1002/2211-5463.12381), licensed under a CC-BY license.")
![Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx−/− mice. (A) Top. Schematic diagram of murine Paxx locus indicating the ATG & STOP sites, & the targeted loci in the promoter region for sgRNA#1 & in exon 2 for sgRNA#2. Bottom. Resulting Paxx−/− locus lacking part of the promoter region, transcription start site, & exon 1. (B) PCR‐based genotyping strategy reveals the Paxx wt allele (965 bp) & Paxx null allele (270 bp). The following samples are presented, from left to right: two Paxx+/+ & two Paxx−/−. (C,D) Western blot analyses using Novus anti‐PAXX immunoglobulins revealed the lack of PAXX protein in Paxx−/− tail fibroblasts, spleen, thymus, liver, & lungs when compared to Paxx+/+ controls & reduction of PAXX protein in Paxx+/− cells. (E) Western blot using Abcam anti‐PAXX immunoglobulins showed no PAXX protein in Paxx−/− & reduction of PAXX protein in Paxx+/− livers compared to Paxx+/+. (F) Analyses of 184 pups born from Paxx+/− parents revealed expected genetic distribution of Paxx+/+ (43), Paxx+/− (89), & Paxx−/− (52) mice, which is close to 1 : 2 : 1 distribution. (G) Body weight of 30‐day‐old Paxx+/+ mice (n = 43) is not distinguishable from Paxx+/− (n = 60, P = 0.9559) & Paxx−/− mice (n = 99, P = 0.9629). Six Ku80−/− mice of the same age were significantly smaller than Paxx+/+, Paxx+/−, & Paxx−/− mice, P < 0.0001. (H) Example of 5‐week‐old mice, Paxx+/+, two Paxx+/−, & Paxx−/−, as indicated. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29511619), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-94172_rabbit-polyclonal-paxx-antibody-31020241613620.jpg "Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx−/− mice. (A) Top. Schematic diagram of murine Paxx locus indicating the ATG & STOP sites, & the targeted loci in the promoter region for sgRNA#1 & in exon 2 for sgRNA#2. Bottom. Resulting Paxx−/− locus lacking part of the promoter region, transcription start site, & exon 1. (B) PCR‐based genotyping strategy reveals the Paxx wt allele (965 bp) & Paxx null allele (270 bp). The following samples are presented, from left to right: two Paxx+/+ & two Paxx−/−. (C,D) Western blot analyses using Novus anti‐PAXX immunoglobulins revealed the lack of PAXX protein in Paxx−/− tail fibroblasts, spleen, thymus, liver, & lungs when compared to Paxx+/+ controls & reduction of PAXX protein in Paxx+/− cells. (E) Western blot using Abcam anti‐PAXX immunoglobulins showed no PAXX protein in Paxx−/− & reduction of PAXX protein in Paxx+/− livers compared to Paxx+/+. (F) Analyses of 184 pups born from Paxx+/− parents revealed expected genetic distribution of Paxx+/+ (43), Paxx+/− (89), & Paxx−/− (52) mice, which is close to 1 : 2 : 1 distribution. (G) Body weight of 30‐day‐old Paxx+/+ mice (n = 43) is not distinguishable from Paxx+/− (n = 60, P = 0.9559) & Paxx−/− mice (n = 99, P = 0.9629). Six Ku80−/− mice of the same age were significantly smaller than Paxx+/+, Paxx+/−, & Paxx−/− mice, P < 0.0001. (H) Example of 5‐week‐old mice, Paxx+/+, two Paxx+/−, & Paxx−/−, as indicated. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29511619), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx−/− mice. (A) Top. Schematic diagram of murine Paxx locus indicating the ATG & STOP sites, & the targeted loci in the promoter region for sgRNA#1 & in exon 2 for sgRNA#2. Bottom. Resulting Paxx−/− locus lacking part of the promoter region, transcription start site, & exon 1. (B) PCR‐based genotyping strategy reveals the Paxx wt allele (965 bp) & Paxx null allele (270 bp). The following samples are presented, from left to right: two Paxx+/+ & two Paxx−/−. (C,D) Western blot analyses using Novus anti‐PAXX immunoglobulins revealed the lack of PAXX protein in Paxx−/− tail fibroblasts, spleen, thymus, liver, & lungs when compared to Paxx+/+ controls & reduction of PAXX protein in Paxx+/− cells. (E) Western blot using Abcam anti‐PAXX immunoglobulins showed no PAXX protein in Paxx−/− & reduction of PAXX protein in Paxx+/− livers compared to Paxx+/+. (F) Analyses of 184 pups born from Paxx+/− parents revealed expected genetic distribution of Paxx+/+ (43), Paxx+/− (89), & Paxx−/− (52) mice, which is close to 1 : 2 : 1 distribution. (G) Body weight of 30‐day‐old Paxx+/+ mice (n = 43) is not distinguishable from Paxx+/− (n = 60, P = 0.9559) & Paxx−/− mice (n = 99, P = 0.9629). Six Ku80−/− mice of the same age were significantly smaller than Paxx+/+, Paxx+/−, & Paxx−/− mice, P < 0.0001. (H) Example of 5‐week‐old mice, Paxx+/+, two Paxx+/−, & Paxx−/−, as indicated. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29511619), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-94172_rabbit-polyclonal-paxx-antibody-310202416114776.jpg "Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx−/− mice. (A) Top. Schematic diagram of murine Paxx locus indicating the ATG & STOP sites, & the targeted loci in the promoter region for sgRNA#1 & in exon 2 for sgRNA#2. Bottom. Resulting Paxx−/− locus lacking part of the promoter region, transcription start site, & exon 1. (B) PCR‐based genotyping strategy reveals the Paxx wt allele (965 bp) & Paxx null allele (270 bp). The following samples are presented, from left to right: two Paxx+/+ & two Paxx−/−. (C,D) Western blot analyses using Novus anti‐PAXX immunoglobulins revealed the lack of PAXX protein in Paxx−/− tail fibroblasts, spleen, thymus, liver, & lungs when compared to Paxx+/+ controls & reduction of PAXX protein in Paxx+/− cells. (E) Western blot using Abcam anti‐PAXX immunoglobulins showed no PAXX protein in Paxx−/− & reduction of PAXX protein in Paxx+/− livers compared to Paxx+/+. (F) Analyses of 184 pups born from Paxx+/− parents revealed expected genetic distribution of Paxx+/+ (43), Paxx+/− (89), & Paxx−/− (52) mice, which is close to 1 : 2 : 1 distribution. (G) Body weight of 30‐day‐old Paxx+/+ mice (n = 43) is not distinguishable from Paxx+/− (n = 60, P = 0.9559) & Paxx−/− mice (n = 99, P = 0.9629). Six Ku80−/− mice of the same age were significantly smaller than Paxx+/+, Paxx+/−, & Paxx−/− mice, P < 0.0001. (H) Example of 5‐week‐old mice, Paxx+/+, two Paxx+/−, & Paxx−/−, as indicated. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29511619), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")