OTOP2 Antibody (6F11)

Sandwich ELISA: OTOP2 Antibody (6F11) [H00092736-M02] - Detection limit for recombinant GST tagged OTOP2 is 0.03 ng/ml as a capture antibody.

Product Discontinued

OTOP2 Antibody (6F11) Summary

• Immunogen: OTOP2 (NP_835454, 423 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESLHRGPPGAEPHSTHPKEPCQDLTFTNLDALHTLSACPPNPGLVSPSPSDQREAVAIVSTPRSQWRRQCL
• Specificity: OTOP2 - otopetrin 2 (6F11)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: OTOP2
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA 1:100 - 1:2000
  • Sandwich ELISA
  • Western Blot 1:100 - 1:2000

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OTOP2 Antibody (6F11)

• otopetrin 2
• otopetrin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OTOP2