Recombinant Human NUPL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NUPL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 323-422 of Human NUPL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NUPL1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NUPL1 Protein

  • KIAA0410PRO2463
  • nucleoporin like 1
  • nucleoporin p58/p45
  • Nucleoporin-like protein 1

Background

This gene encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-13885
Species: Hu
NBP2-13483
Species: Hu
Applications: IHC, IHC-P
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2244
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP

Publications for NUPL1 Partial Recombinant Protein (H00009818-Q01) (0)

There are no publications for NUPL1 Partial Recombinant Protein (H00009818-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUPL1 Partial Recombinant Protein (H00009818-Q01) (0)

There are no reviews for NUPL1 Partial Recombinant Protein (H00009818-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUPL1 Partial Recombinant Protein (H00009818-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NUPL1 Products

Bioinformatics Tool for NUPL1 Partial Recombinant Protein (H00009818-Q01)

Discover related pathways, diseases and genes to NUPL1 Partial Recombinant Protein (H00009818-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NUPL1

There are no specific blogs for NUPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CRM1 Antibody
NB100-79802
NUPL1 Antibody
NBP2-13684
RanBP1 Antibody
NB100-79814

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NUPL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NUPL1