NUDT16L1 Antibody

Images

 
Western Blot: NUDT16L1 Antibody [NBP1-55432] - HepG2 cell lysate, concentration 5.0ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDT16L1 Antibody Summary

Immunogen
Synthetic peptides corresponding to NUDT16L1(nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1) The peptide sequence was selected from the C terminal of NUDT16L1. Peptide sequence GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT16L1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NUDT16L1 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NUDT16L1 Antibody

  • MGC11275
  • nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1
  • protein syndesmos
  • SDOSNUDT16-like protein 1

Background

NUDT16L1 is a probable adapter protein, which may link syndecan-4 (SDC4) and paxilin (TGFB1I1 and PXN) receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUDT16L1 Antibody (NBP1-55432) (0)

There are no publications for NUDT16L1 Antibody (NBP1-55432).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT16L1 Antibody (NBP1-55432) (0)

There are no reviews for NUDT16L1 Antibody (NBP1-55432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT16L1 Antibody (NBP1-55432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NUDT16L1 Products

Bioinformatics Tool for NUDT16L1 Antibody (NBP1-55432)

Discover related pathways, diseases and genes to NUDT16L1 Antibody (NBP1-55432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NUDT16L1

There are no specific blogs for NUDT16L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT16L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT16L1
Uniprot