NT5DC2 Antibody

Images

 
Western Blot: NT5DC2 Antibody [NBP1-70660] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: NT5DC2 Antibody [NBP1-70660] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: NT5DC2 Antibody [NBP1-70660] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NT5DC2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NT5DC2 (5'-nucleotidase domain containing 2) The peptide sequence was selected from the N terminal of NT5DC2. Peptide sequence IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NT5DC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NT5DC2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NT5DC2 Antibody

  • 5'-nucleotidase domain containing 2

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NT5DC2 Antibody (NBP1-70660) (0)

There are no publications for NT5DC2 Antibody (NBP1-70660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5DC2 Antibody (NBP1-70660) (0)

There are no reviews for NT5DC2 Antibody (NBP1-70660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NT5DC2 Antibody (NBP1-70660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NT5DC2 Products

NT5DC2 NBP1-70660

Bioinformatics Tool for NT5DC2 Antibody (NBP1-70660)

Discover related pathways, diseases and genes to NT5DC2 Antibody (NBP1-70660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NT5DC2

There are no specific blogs for NT5DC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NT5DC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5DC2