NOL1R2 Antibody


Western Blot: NOL1R2 Antibody [NBP1-70655] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NOL1R2 Antibody Summary

Synthetic peptides corresponding to NSUN5C(NOL1/NOP2/Sun domain family, member 5C) The peptide sequence was selected from the middle region of NSUN5C. Peptide sequence PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NSUN5C and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NOL1R2 Antibody

  • NSUN5C
  • NSUN5P2 NOP2/Sun domain family, member 5 pseudogene 2
  • WBSCR20B
  • WBSCR20C


NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder.This gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NOL1R2 Antibody (NBP1-70655) (0)

There are no publications for NOL1R2 Antibody (NBP1-70655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOL1R2 Antibody (NBP1-70655) (0)

There are no reviews for NOL1R2 Antibody (NBP1-70655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOL1R2 Antibody (NBP1-70655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NOL1R2 Products

NOL1R2 NBP1-70655

Bioinformatics Tool for NOL1R2 Antibody (NBP1-70655)

Discover related pathways, diseases and genes to NOL1R2 Antibody (NBP1-70655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NOL1R2

There are no specific blogs for NOL1R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NOL1R2 Antibody and receive a gift card or discount.


Gene Symbol NSUN5C