NKAIN4 Antibody

Images

 
Western Blot: NKAIN4 Antibody [NBP1-90809] - Analysis in control (vector only transfected HEK293T lysate) and NKAIN4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: NKAIN4 Antibody [NBP1-90809] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKAIN4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NKAIN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NKAIN4 Protein (NBP1-90809PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NKAIN4 Antibody

  • Na+/K+ transporting ATPase interacting 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NKAIN4 Antibody (NBP1-90809) (0)

There are no publications for NKAIN4 Antibody (NBP1-90809).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKAIN4 Antibody (NBP1-90809) (0)

There are no reviews for NKAIN4 Antibody (NBP1-90809). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKAIN4 Antibody (NBP1-90809) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NKAIN4 Products

Bioinformatics Tool for NKAIN4 Antibody (NBP1-90809)

Discover related pathways, diseases and genes to NKAIN4 Antibody (NBP1-90809). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NKAIN4

There are no specific blogs for NKAIN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKAIN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NKAIN4