NEPRO Antibody

Images

 
Western Blot: C3orf17 Antibody [NBP1-59919] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEPRO Antibody Summary

Immunogen
Synthetic peptides corresponding to C3ORF17 The peptide sequence was selected from the middle region of C3ORF17. Peptide sequence KLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDLYPNSKQLLNS.
Predicted Species
Human (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C3ORF17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C3orf17 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NEPRO Antibody

  • C3orf17
  • chromosome 3 open reading frame 17
  • DKFZP434F2021
  • hypothetical protein LOC25871
  • NET17

Background

The function of the C3orf17 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NEPRO Antibody (NBP1-59919) (0)

There are no publications for NEPRO Antibody (NBP1-59919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEPRO Antibody (NBP1-59919) (0)

There are no reviews for NEPRO Antibody (NBP1-59919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEPRO Antibody (NBP1-59919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NEPRO Products

Bioinformatics Tool for NEPRO Antibody (NBP1-59919)

Discover related pathways, diseases and genes to NEPRO Antibody (NBP1-59919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NEPRO

There are no specific blogs for NEPRO, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEPRO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C3ORF17
Uniprot