![Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining in human liver and skeletal muscle tissues using anti-NADK2 antibody. Corresponding NADK2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NADKD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83547-img0010.jpg "Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining in human liver and skeletal muscle tissues using anti-NADK2 antibody. Corresponding NADK2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RALNIERAHDERSEASGPQLLPVRALNEVFIGESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NADK2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Shinichi Oka |
WB | Mouse and Rat | 08/29/2023 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NADK2 |
![Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human colon, liver, lymph node and skeletal muscle using Anti-NADK2 antibody NBP1-83547 (A) shows similar protein distribution across tissues to independent antibody NBP2-48680 (B).](http://images.novusbio.com/fullsize/NADKD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83547-img0011.jpg "Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human colon, liver, lymph node and skeletal muscle using Anti-NADK2 antibody NBP1-83547 (A) shows similar protein distribution across tissues to independent antibody NBP2-48680 (B).")
![Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human lymph node.](http://images.novusbio.com/fullsize/NADKD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83547-img0013.jpg "Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human lymph node.")
![Western Blot: NADKD1 Antibody [NBP1-83547] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/NADKD1-Antibody-Western-Blot-NBP1-83547-img0008.jpg "Western Blot: NADKD1 Antibody [NBP1-83547] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/NADKD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83547-img0002.jpg "Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/NADKD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83547-img0009.jpg "Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human colon.](http://images.novusbio.com/fullsize/NADKD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83547-img0012.jpg "Immunohistochemistry-Paraffin: NADKD1 Antibody [NBP1-83547] - Staining of human colon.")
![Western Blot: Rabbit Polyclonal NADKD1 Antibody [NBP1-83547] - Rat primary neonatal cardiomyocytes transduced with adenovirus vector expressing mouse NADKD1. Image from verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-83547_rabbit-polyclonal-nadkd1-antibody-western-blot-69202313454..jpg "Western Blot: Rabbit Polyclonal NADKD1 Antibody [NBP1-83547] - Rat primary neonatal cardiomyocytes transduced with adenovirus vector expressing mouse NADKD1. Image from verified customer review.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
