Recombinant Human MRPS24 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRPS24 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-167 of Human MRPS24 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MRPS24
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPS24 Protein

  • 28S ribosomal protein S24, mitochondrial
  • bMRP47
  • bMRP-47
  • mitochondrial 28S ribosomal protein S24
  • mitochondrial ribosomal protein S24
  • MRP-S24HSPC335
  • S24mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 11. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80803
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for MRPS24 Recombinant Protein (H00064951-P01) (0)

There are no publications for MRPS24 Recombinant Protein (H00064951-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS24 Recombinant Protein (H00064951-P01) (0)

There are no reviews for MRPS24 Recombinant Protein (H00064951-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS24 Recombinant Protein (H00064951-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS24 Products

Bioinformatics Tool for MRPS24 Recombinant Protein (H00064951-P01)

Discover related pathways, diseases and genes to MRPS24 Recombinant Protein (H00064951-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS24 Recombinant Protein (H00064951-P01)

Discover more about diseases related to MRPS24 Recombinant Protein (H00064951-P01).

Blogs on MRPS24

There are no specific blogs for MRPS24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRPS24 Antibody
NBP1-92140
RPS24 Antibody
NBP1-80803

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPS24 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS24