Recombinant Human MRPS21 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRPS21 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 87 of Human MRPS21 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MRPS21

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPS21 Protein

  • 28S ribosomal protein S21, mitochondrial
  • mitochondrial 28S ribosomal protein S21
  • mitochondrial ribosomal protein S21
  • MRP-S21
  • RPMS21
  • S21mt

Background

MRPS21( AAH04566, 1 a.a. - 88 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45912
Species: Hu
Applications: WB, IHC
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-88425
Species: Hu
Applications: IHC, IHC-P

Publications for MRPS21 Recombinant Protein (H00054460-P01) (0)

There are no publications for MRPS21 Recombinant Protein (H00054460-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS21 Recombinant Protein (H00054460-P01) (0)

There are no reviews for MRPS21 Recombinant Protein (H00054460-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS21 Recombinant Protein (H00054460-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS21 Products

Bioinformatics Tool for MRPS21 Recombinant Protein (H00054460-P01)

Discover related pathways, diseases and genes to MRPS21 Recombinant Protein (H00054460-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MRPS21 Recombinant Protein (H00054460-P01)

View related products by pathway.

PTMs for MRPS21 Recombinant Protein (H00054460-P01)

Learn more about PTMs related to MRPS21 Recombinant Protein (H00054460-P01).

Blogs on MRPS21

There are no specific blogs for MRPS21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRPS21 Antibody
NBP2-58866
ACADVL Antibody
NBP1-54378

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPS21 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS21