Methyltransferase like 6 Antibody

Images

 
Western Blot: Methyltransferase like 6 Antibody [H00131965-B01P] - Analysis of METTL6 expression in transfected 293T cell line by METTL6 polyclonal antibody. Lane 1: METTL6 transfected lysate(28.05 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Methyltransferase like 6 Antibody Summary

Immunogen
METTL6 (AAH22400.1, 1 a.a. - 255 a.a.) full-length human protein. MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGL
Specificity
METTL6 - methyltransferase like 6,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
METTL6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Methyltransferase like 6 Antibody

  • EC 2.1.1
  • EC 2.1.1.-
  • EC 2.1.1.41
  • methyltransferase like 6
  • methyltransferase-like protein 6
  • MGC24132

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-03077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC

Publications for Methyltransferase like 6 Antibody (H00131965-B01P) (0)

There are no publications for Methyltransferase like 6 Antibody (H00131965-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methyltransferase like 6 Antibody (H00131965-B01P) (0)

There are no reviews for Methyltransferase like 6 Antibody (H00131965-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Methyltransferase like 6 Antibody (H00131965-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Methyltransferase like 6 Products

Bioinformatics Tool for Methyltransferase like 6 Antibody (H00131965-B01P)

Discover related pathways, diseases and genes to Methyltransferase like 6 Antibody (H00131965-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methyltransferase like 6 Antibody (H00131965-B01P)

Discover more about diseases related to Methyltransferase like 6 Antibody (H00131965-B01P).

Research Areas for Methyltransferase like 6 Antibody (H00131965-B01P)

Find related products by research area.

Blogs on Methyltransferase like 6

There are no specific blogs for Methyltransferase like 6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methyltransferase like 6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL6
Entrez
Uniprot