Recombinant Human MAGED4B GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MAGED4B GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-333 of Human MAGED4B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MIKDYKKIPIKRADMLKDVIREYDEHFPEIIERATYTLEKKFGIHLKEIDKEEHLYILVCTRDSSARLLGKTKDTPRLSLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPFLGDLRKLITDDFVKQKNPELREETPLSMAPSWYLEYKKIPNSNPPEYEFLWGLRARHETSKMRVLRFIAQNQNRDPREWKAHFLEAVDDAFKTMDVDMAEEHARAQMRAQMNIGDEALIGRWSWDDIQVELLTWDEDGDFGDAWARIPFAFWARYHQYILNSNRANRRATWRAGVSSGTNGGASTSVLDGPSTSSTIRTRNAARAGASFFSWIQHR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
MAGED4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
65.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAGED4B GST (N-Term) Protein

  • KIAA1859FLJ39060
  • MAGE1
  • MAGE-D4 antigen
  • MAGE-E1 antigen
  • MAGE-E1
  • MAGEE1MAGED4A
  • melanoma antigen family D, 4
  • MGC3210

Background

This gene is a member of the MAGED gene family. It is expressed only in brain and ovary among normal tissues, and two transcript variants of this gene are specifically expressed in glioma cells among cancer cells. This gene and the other MAGED genes are clustered on chromosome Xp11. Multiple alternatively spliced transcript variants have been found for this gene, however, the full-length nature of some variants has not been defined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006907-M07
Species: Hu
Applications: ELISA, IHC, IHC-P, PLA, S-ELISA
NBP2-46836
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87691
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31176
Species: Hu, Mu, Po, Sh
Applications: ELISA, IHC, IHC-P
NBP1-32435
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-00129
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00055906-B01P
Species: Hu
Applications: WB
NBP2-33471
Species: Hu
Applications: IHC, IHC-P

Publications for MAGED4B Recombinant Protein (H00081557-P01) (0)

There are no publications for MAGED4B Recombinant Protein (H00081557-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGED4B Recombinant Protein (H00081557-P01) (0)

There are no reviews for MAGED4B Recombinant Protein (H00081557-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGED4B Recombinant Protein (H00081557-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGED4B Products

Bioinformatics Tool for MAGED4B Recombinant Protein (H00081557-P01)

Discover related pathways, diseases and genes to MAGED4B Recombinant Protein (H00081557-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGED4B Recombinant Protein (H00081557-P01)

Discover more about diseases related to MAGED4B Recombinant Protein (H00081557-P01).
 

Pathways for MAGED4B Recombinant Protein (H00081557-P01)

View related products by pathway.

Blogs on MAGED4B

There are no specific blogs for MAGED4B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAGED4B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGED4B