LRRN4CL Antibody


Western Blot: LRRN4CL Antibody [NBP1-60105] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LRRN4CL Antibody Summary

Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LOC221091 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRRN4CL Antibody

  • LRRN4 C-terminal like
  • LRRN4 C-terminal-like protein
  • MGC61707


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRRN4CL Antibody (NBP1-60105) (0)

There are no publications for LRRN4CL Antibody (NBP1-60105).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRN4CL Antibody (NBP1-60105) (0)

There are no reviews for LRRN4CL Antibody (NBP1-60105). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRN4CL Antibody (NBP1-60105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LRRN4CL Products

Bioinformatics Tool for LRRN4CL Antibody (NBP1-60105)

Discover related pathways, diseases and genes to LRRN4CL Antibody (NBP1-60105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LRRN4CL

There are no specific blogs for LRRN4CL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRRN4CL Antibody and receive a gift card or discount.


Gene Symbol LRRN4CL