LRRN4CL Antibody

Images

 
Western Blot: LRRN4CL Antibody [NBP1-60105] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

LRRN4CL Antibody Summary

Immunogen
Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA.
Clonality
Polyclonal
Host
Rabbit
Gene
LRRN4CL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LOC221091 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRRN4CL Antibody

  • LRRN4 C-terminal like
  • LRRN4 C-terminal-like protein
  • MGC61707

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRRN4CL Antibody (NBP1-60105) (0)

There are no publications for LRRN4CL Antibody (NBP1-60105).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRN4CL Antibody (NBP1-60105) (0)

There are no reviews for LRRN4CL Antibody (NBP1-60105). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRN4CL Antibody (NBP1-60105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRN4CL Antibody Products

Bioinformatics Tool for LRRN4CL Antibody (NBP1-60105)

Discover related pathways, diseases and genes to LRRN4CL Antibody (NBP1-60105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LRRN4CL

There are no specific blogs for LRRN4CL, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol LRRN4CL
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-60105 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought