LCA5L Antibody


Western Blot: LCA5L Antibody [NBP1-70597] - Antibody Titration: 5% Milk. Mouse Brain lysate
Western Blot: LCA5L Antibody [NBP1-70597] - MCF7 cell lysate, Antibody Titration: 0.2-1 ug/ml

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

LCA5L Antibody Summary

Synthetic peptides corresponding to C21ORF13 The peptide sequence was selected from the N terminal of C21ORF13. Peptide sequence SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C21orf13 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LCA5L Antibody

  • C21orf13
  • leber congenital amaurosis 5-like protein
  • Leber congenital amaurosis 5-like
  • Lebercilin-like protein
  • MGC33295


The function of the C21orf13 protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LCA5L Antibody (NBP1-70597) (0)

There are no publications for LCA5L Antibody (NBP1-70597).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCA5L Antibody (NBP1-70597) (0)

There are no reviews for LCA5L Antibody (NBP1-70597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCA5L Antibody (NBP1-70597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LCA5L Products

LCA5L NBP1-70597

Bioinformatics Tool for LCA5L Antibody (NBP1-70597)

Discover related pathways, diseases and genes to LCA5L Antibody (NBP1-70597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LCA5L

There are no specific blogs for LCA5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LCA5L Antibody and receive a gift card or discount.


Gene Symbol LCA5L