LAMB4 Antibody

Images

 
Immunohistochemistry: LAMB4 Antibody [NBP2-14182] - Staining of human stomach shows moderate positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAMB4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDHAVNAKVQAESAQHQAGSLEKEFVELKKQYAILQRKTSTTGLTKETLG KVKQLKDAAEKLAGDTEAKIRRITDLERKIQDLNLSRQAKADQLRILEDQ VVAI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LAMB4 Protein (NBP2-14182PEP)
Publications
Read Publication using NBP2-14182.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAMB4 Antibody

  • LAMB4 laminin, beta 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88074
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LAMB4 Antibody (NBP2-14182)(1)

Reviews for LAMB4 Antibody (NBP2-14182) (0)

There are no reviews for LAMB4 Antibody (NBP2-14182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LAMB4 Antibody (NBP2-14182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAMB4 Products

LAMB4 NBP2-14182

Bioinformatics Tool for LAMB4 Antibody (NBP2-14182)

Discover related pathways, diseases and genes to LAMB4 Antibody (NBP2-14182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAMB4 Antibody (NBP2-14182)

Discover more about diseases related to LAMB4 Antibody (NBP2-14182).

Blogs on LAMB4

There are no specific blogs for LAMB4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAMB4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB4