Kv9.2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Kv9.2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNS2.
  
  

  Source: E. coli

  Amino Acid Sequence: MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KCNS2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14145.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv9.2 Recombinant Protein Antigen

• Delayed-rectifier K(+) channel alpha subunit 2
• KIAA1144
• KV9.2
• potassium voltage-gated channel subfamily S member 2
• potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2
• Voltage-gated potassium channel subunit Kv9.2

Background

Voltage-gated K+ channels in the plasma membrane control the repolarization and the frequency of action potentials in neurons, muscles and other excitable cells. The KV gene family encodes more than 30 proteins that comprise the subunits of the K+ channels, and they vary in their gating and permeation properties, subcellular distribution and expression patterns. Functional KV channels assemble as tetramers consisting of pore-forming alpha subunits (KV), which include the KV1, KV2, KV3, KV4 and KV9 proteins, and accessory or KV-subunits that modify the gating properties of the coexpressed KV subunits. KV9.2 is a K+ channel subunit that reduces the ion flow and regulates channel activity. It localizes to the cell membrane and, in the absence of KCNB1, KV9.2 may not reach the plasma membrane and may remain in an intracellular compartment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KCNS2