KRTAP23-1 Antibody

Images

 
Western Blot: KRTAP23-1 Antibody [NBP1-70596] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRTAP23-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to KRTAP23-1 (keratin associated protein 23-1) The peptide sequence was selected from the middle region of KRTAP23-1. Peptide sequence CEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRTAP23-1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KRTAP23-1 and was validated on Western blot.
Theoretical MW
7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KRTAP23-1 Antibody

  • KAP23.1keratin-associated protein 23-1
  • keratin associated protein 23-1

Background

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KRTAP23-1 Antibody (NBP1-70596) (0)

There are no publications for KRTAP23-1 Antibody (NBP1-70596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRTAP23-1 Antibody (NBP1-70596) (0)

There are no reviews for KRTAP23-1 Antibody (NBP1-70596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRTAP23-1 Antibody (NBP1-70596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRTAP23-1 Products

KRTAP23-1 NBP1-70596

Bioinformatics Tool for KRTAP23-1 Antibody (NBP1-70596)

Discover related pathways, diseases and genes to KRTAP23-1 Antibody (NBP1-70596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRTAP23-1

There are no specific blogs for KRTAP23-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRTAP23-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRTAP23-1