![Western Blot: KPRP Antibody [H00448834-B01P-50ug] - analysis of KPRP expression in transfected 293T cell line (H00448834-T01) by KPRP MaxPab polyclonal antibody.Lane 1: KPRP transfected lysate(63.69 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/KPRP-Antibody-Western-Blot-H00448834-B01P-50ug-img0001.jpg "Western Blot: KPRP Antibody [H00448834-B01P-50ug] - analysis of KPRP expression in transfected 293T cell line (H00448834-T01) by KPRP MaxPab polyclonal antibody.Lane 1: KPRP transfected lysate(63.69 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse KPRP Antibody - Azide and BSA Free (H00448834-B01P-50ug) is a polyclonal antibody validated for use in WB. Anti-KPRP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | KPRP (NP_001020402.1, 1 a.a. - 579 a.a.) full-length human protein. MCDQQQIQCRLPLQQCCVKGPSFCSSQSPFAQSQVVVQAPCEMQIVDCPASCPVQVCQVSDQAPCQSQTTQVKCQSKTKQVKGQAQCQSKTTQVKGQAASQSQTSSVQSQAPCQSEVSYVQCEASQPVQTCFVECAPVCYTETCYVECPVQNYVPCPAPQPVQMYRGRPAVCQPQGRFSTQCQYQGSYSSCGPQFQSRATCNNYTPQFQLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSYGSFTEQHRSRSTSRCLPPPRRLQLFPRSCSPPRRFEPCSSSYLPLRPSEGFPNYCTPPRRSEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPRQVPPQRCPVEIPPIRRRSQSCGPQPSWGASCPELRPHVEPRPLPSFCPPRRLDQCPESPLQRCPPPAPRPRLRPEPCISLEPRPRPLPRQLSEPCLYPEPLPALRPTPRPVPLPRPGQCEIPEPRPCLQPCEHPEPCPRPEPIPLPAPCPSPEPCRETWRSPSPCWGPNPVPYPGDLGCHESSPHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAGVKGEAKSAYF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | KPRP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Immunogen affinity purified |
| Publication using H00448834-B01P-50ug | Applications | Species |
|---|---|---|
| Suga H, Oka T, Sugaya M et al. Keratinocyte Proline-Rich Protein Deficiency in Atopic Dermatitis Leads to Barrier Disruption. J Invest Dermatol. 2019-03-21 [PMID: 30905808] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KPRP |
| Entrez |
|
| Uniprot |
|
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")