KLHDC8A Antibody


Western Blot: KLHDC8A Antibody [NBP1-57421] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB

Order Details

KLHDC8A Antibody Summary

Synthetic peptides corresponding to KLHDC8A(kelch domain containing 8A) The peptide sequence was selected from the middle region of KLHDC8A. Peptide sequence NQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQG.
Predicted Species
Human (100%), Mouse (93%), Rat (100%), Canine (100%), Equine (93%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KLHDC8A and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLHDC8A Antibody

  • FLJ10748
  • kelch domain containing 8A
  • kelch domain-containing protein 8A


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KLHDC8A Antibody (NBP1-57421) (0)

There are no publications for KLHDC8A Antibody (NBP1-57421).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHDC8A Antibody (NBP1-57421) (0)

There are no reviews for KLHDC8A Antibody (NBP1-57421). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHDC8A Antibody (NBP1-57421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional KLHDC8A Products

Bioinformatics Tool for KLHDC8A Antibody (NBP1-57421)

Discover related pathways, diseases and genes to KLHDC8A Antibody (NBP1-57421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KLHDC8A

There are no specific blogs for KLHDC8A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KLHDC8A Antibody and receive a gift card or discount.


Gene Symbol KLHDC8A