JMJD4 Antibody


Western Blot: JMJD4 Antibody [NBP2-87649] - WB Suggested Anti-JMJD4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate

Product Details

Reactivity Hu, Mu, Rt, PoSpecies Glossary
Applications WB

Order Details

JMJD4 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of human JMJD4. Peptide sequence: AAFDVGRITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (91%), Rat (91%), Porcine (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for JMJD4 Antibody

  • FLJ12517
  • jumonji domain containing 4
  • jumonji domain-containing protein 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for JMJD4 Antibody (NBP2-87649) (0)

There are no publications for JMJD4 Antibody (NBP2-87649).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JMJD4 Antibody (NBP2-87649) (0)

There are no reviews for JMJD4 Antibody (NBP2-87649). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JMJD4 Antibody (NBP2-87649) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional JMJD4 Products

Array NBP2-87649

Bioinformatics Tool for JMJD4 Antibody (NBP2-87649)

Discover related pathways, diseases and genes to JMJD4 Antibody (NBP2-87649). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on JMJD4

There are no specific blogs for JMJD4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our JMJD4 Antibody and receive a gift card or discount.


Gene Symbol JMJD4