![Western Blot: ISOC2 Antibody [NBP2-85116] - Host: Rabbit. Target Name: ISOC2. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/ISOC2-Antibody-Western-Blot-NBP2-85116-img0001.jpg "Western Blot: ISOC2 Antibody [NBP2-85116] - Host: Rabbit. Target Name: ISOC2. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ISOC2. Peptide sequence: EKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQYPQGLGPTVPELGT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ISOC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.](http://images.novusbio.com/images2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0006.jpg)
![Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.](http://images.novusbio.com/images2/p19ARF-CDKN2A-Antibody-Western-Blot-NB200-106-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/images2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for ISOC2 Antibody (NBP2-85116)Discover more about diseases related to ISOC2 Antibody (NBP2-85116).
|
Research Areas for ISOC2 Antibody (NBP2-85116)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ISOC2 |
![Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/HDAC9-Antibody-Western-Blot-NBP2-03993-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
