IQCK Antibody

Images

 
Western Blot: IQCK Antibody [NBP1-83486] - Analysis in control (vector only transfected HEK293T lysate) and IQCK over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: IQCK Antibody [NBP1-83486] - Staining of human fallopian tube shows strong positivity in cilia of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IQCK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IQCK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
IHC reported in scientific literature (PMID: 24708576). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IQCK Protein (NBP1-83486PEP)
Publications
Read Publication using
NBP1-83486 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%). Human reactivity reported in scientific literature (PMID: 24708576).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IQCK Antibody

  • FLJ20115
  • FLJ36575
  • IQ domain-containing protein K
  • IQ motif containing K
  • MGC35048

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IQCK Antibody (NBP1-83486)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for IQCK Antibody (NBP1-83486) (0)

There are no reviews for IQCK Antibody (NBP1-83486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IQCK Antibody (NBP1-83486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IQCK Products

Bioinformatics Tool for IQCK Antibody (NBP1-83486)

Discover related pathways, diseases and genes to IQCK Antibody (NBP1-83486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on IQCK

There are no specific blogs for IQCK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IQCK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IQCK