| Reactivity | V-ViSpecies Glossary |
| Applications | WB, ELISA |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Janelia Fluor 646 |
| Immunogen | Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla |
| Specificity | This antibody detects a 24 kDa recombinant protein. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | gag |
| Purity | Peptide affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Optimal dilution of this antibody should be experimentally determined. |
| Storage | Store at 4C in the dark. |
| Buffer | 50mM Sodium Borate |
| Preservative | 0.05% Sodium Azide |
| Purity | Peptide affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | gag |