HIST1H2AB Antibody (1P5B6)

Western Blot: HIST1H2AB Antibody (1P5B6) [NBP3-15591] - Western blot analysis of extracts of Rat liver, using HIST1H2AB Rabbit mAb (NBP3-15591) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Western Blot: HIST1H2AB Antibody (1P5B6) [NBP3-15591] - Western blot analysis of extracts of various cell lines, using HIST1H2AB Rabbit mAb (NBP3-15591) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunoprecipitation: HIST1H2AB Antibody (1P5B6) [NBP3-15591] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug HIST1H2AB antibody (NBP3-15591). Western blot was performed from the immunoprecipitate using HIST1H2AB antibody (NBP3-15591) at a dilition of 1:1000.

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Human breast using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Rat liver using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Human colon using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Rat colon using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Human brain using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP
• Clone: 1P5B6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

HIST1H2AB Antibody (1P5B6) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HIST1H2AB (P04908). MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: H2AC4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100 - 1:500
  • Immunohistochemistry-Paraffin 1:100 - 1:500
  • Immunoprecipitation 1:100 - 1:500
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HIST1H2AB Antibody (1P5B6)

• histone H2A type 1-B/E
• H2A/m
• H2AFM
• histone cluster 1, H2ab

Background

HIST1H2AB is 130 amino acids long, weighs approximately 14 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Current studies are being done on several diseases and disorders including riddle syndrome, systemic lupus erythematosus, lupus erythematosus, cockayne syndrome, hemochromatosis, and immunodeficiency. HIST1H2AB has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the proteasome degradation, telomere maintenance, nucleosome assembly, cell cycle, and systemic lupus erythematosus pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H2AC4