HHLA3 Antibody (1F6) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: HHLA3 Antibody (1F6) [H00011147-M01] - Analysis of monoclonal antibody to HHLA3 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: HHLA3 Antibody (1F6) [H00011147-M01] - Detection limit for recombinant GST tagged HHLA3 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1F6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HHLA3 Antibody (1F6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse HHLA3 Antibody (1F6) - Azide and BSA Free (H00011147-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: HHLA3 (NP_009002, 1 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAV
• Specificity: HHLA3 - HERV-H LTR-associating 3
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HHLA3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HHLA3 Antibody (1F6) - Azide and BSA Free

• HERV-H LTR-associating 3
• HERV-H LTR-associating protein 3
• human endogenous retrovirus-H long terminal repeat-associating 3
• Human endogenous retrovirus-H long terminal repeat-associating protein 3

Background

The HHLA3 gene codes for a HERV-H LTR-associating protein 3 that exists in 3 types: type 1 is 76 AA long at 8 8 kDA, type 2 is 121 AA long at 13 kDA, and type 3 is 114 AA long at nearly 13 kDA. The HHLA3 gene has been known to interact with genes NMI, CHRM3, LRRC29, PCDH15, and TP53BP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HHLA3
• Entrez:
  • 11147(Human)
• OMIM:
  • 604372(Human)