Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free

Western Blot: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446] - Rabbit Anti-RP11-78J21.1 Antibody. Paraffin Embedded Tissue: Human Skin. Cellular Data: Epidermal cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Immunohistochemistry-Paraffin: Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody [NBP1-80446] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human RP11-78J21. 1. Peptide sequence MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPA1L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Heterogeneous Nuclear Ribonucleoprotein (A1-like) Antibody - BSA Free

• heterogeneous nuclear ribonucleoprotein A1-like 2
• hnRNP A1-like 2
• hnRNP core protein A1-like 2
• HNRNPA1L
• LOC144983
• MGC102957

Background

The HNRNPA1 gene encodes a heterogeneous nuclear ribonucleoprotein A1-like (part of the hnRNPs) that functions in various processes such as the ordering of pre-mRNA into hnRNP particles, the transport of poly(A) mRNA to the cytoplams from the nucleus, as well as plays a part in the regulation of splice site selection. Additionally, HNRNPA1 also functions in HCV RNA replication. This gene functions in mRNA splicing and processing, coregulation of adrogen receptor activity, and in translational control. it has been known to interact with various genes such as DDV5, ILF3, DDX17, HNRNPC, and ABHD16A. HNRNPA1 has been researched in various diseases including: cystic fibrosis, colorectal cancer, crohn's disease, spinal cord disease, human t-cell leukemia virus type 1 and type 2, muscular atrophy, stomatitis, and metastasis efficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPA1L2
• Uniprot:
  • NP_001011724(Human)