Recombinant Human H2BFWT Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human H2BFWT Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 31 - 130 of Human H2BFWT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGHLARSTKR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
H2BFWT

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl, 100 mM NaCl, pH 8.0, 1 mM dithiothreitol, 30% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human H2BFWT Protein

  • H2B histone family member W testis-specific
  • H2B histone family, member W, testis-specific
  • histone H2B type W-T
  • MGC148130
  • MGC148131

Background

Testis-specific histones, like H2BFWT, are synthesized and accumulate at specific stages of mammalian spermatogenesis. Their proposed functions range from facilitation of the replacement of somatic histones by protamines to epigenetic control of gene transcription (Churikov et al., 2004 [PubMed 15475252]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56633
Species: Hu
Applications: WB
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00158983-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for H2BFWT Partial Recombinant Protein (H00158983-Q01) (0)

There are no publications for H2BFWT Partial Recombinant Protein (H00158983-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H2BFWT Partial Recombinant Protein (H00158983-Q01) (0)

There are no reviews for H2BFWT Partial Recombinant Protein (H00158983-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for H2BFWT Partial Recombinant Protein (H00158983-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional H2BFWT Products

Bioinformatics Tool for H2BFWT Partial Recombinant Protein (H00158983-Q01)

Discover related pathways, diseases and genes to H2BFWT Partial Recombinant Protein (H00158983-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H2BFWT Partial Recombinant Protein (H00158983-Q01)

Discover more about diseases related to H2BFWT Partial Recombinant Protein (H00158983-Q01).
 

Pathways for H2BFWT Partial Recombinant Protein (H00158983-Q01)

View related products by pathway.

Blogs on H2BFWT

There are no specific blogs for H2BFWT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

H2BFWT Antibody
NBP2-30738

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human H2BFWT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol H2BFWT