Gm13178 Antibody


Western Blot: Gm13178 Antibody [NBP1-74203] - Mouse Kidney Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

Gm13178 Antibody Summary

Synthetic peptides corresponding to the C terminal of Gm13178. Immunizing peptide sequence TFLVSCEHDVLRDDALLYKKRLEDQGVPVSWYHAEDGFHGCISLFDKQPF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Gm13178 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Gm13178 Antibody

  • hypothetical protein LOC546849
  • predicted gene 13178


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Gm13178 Antibody (NBP1-74203) (0)

There are no publications for Gm13178 Antibody (NBP1-74203).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gm13178 Antibody (NBP1-74203) (0)

There are no reviews for Gm13178 Antibody (NBP1-74203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gm13178 Antibody (NBP1-74203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Gm13178 Products

Gm13178 NBP1-74203

Bioinformatics Tool for Gm13178 Antibody (NBP1-74203)

Discover related pathways, diseases and genes to Gm13178 Antibody (NBP1-74203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Gm13178

There are no specific blogs for Gm13178, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Gm13178 Antibody and receive a gift card or discount.


Gene Symbol GM13178