GLTPD2 Antibody


Western Blot: GLTPD2 Antibody [NBP1-80542] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

GLTPD2 Antibody Summary

Synthetic peptide directed towards the N terminal of human LOC388323. Peptide sequence GARSGCGPRAQPCVPGETAPFQVRQESGTLEAPERKQPPCLGPRGMLGRM. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against LOC388323 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GLTPD2 Antibody

  • glycolipid transfer protein domain containing 2
  • glycolipid transfer protein domain-containing protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GLTPD2 Antibody (NBP1-80542) (0)

There are no publications for GLTPD2 Antibody (NBP1-80542).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLTPD2 Antibody (NBP1-80542) (0)

There are no reviews for GLTPD2 Antibody (NBP1-80542). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLTPD2 Antibody (NBP1-80542) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GLTPD2 Products

Bioinformatics Tool for GLTPD2 Antibody (NBP1-80542)

Discover related pathways, diseases and genes to GLTPD2 Antibody (NBP1-80542). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GLTPD2

There are no specific blogs for GLTPD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GLTPD2 Antibody and receive a gift card or discount.


Gene Symbol GLTPD2