Recombinant Human GLI4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GLI4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-376 of Human GLI4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GLI4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GLI4 Protein

  • GLI family zinc finger 4
  • GLI-Kruppel family member GLI4
  • glioma-associated oncogene family zinc finger 4
  • HKR4GLI-Kruppel family member GLI4 (oncogene HKR4)
  • Krueppel-related zinc finger protein 4
  • Protein HKR4
  • zinc finger protein GLI4
  • ZNF928

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-81631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
H00002738-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GLI4 Recombinant Protein (H00002738-P01) (0)

There are no publications for GLI4 Recombinant Protein (H00002738-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI4 Recombinant Protein (H00002738-P01) (0)

There are no reviews for GLI4 Recombinant Protein (H00002738-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLI4 Recombinant Protein (H00002738-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLI4 Products

Bioinformatics Tool for GLI4 Recombinant Protein (H00002738-P01)

Discover related pathways, diseases and genes to GLI4 Recombinant Protein (H00002738-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI4 Recombinant Protein (H00002738-P01)

Discover more about diseases related to GLI4 Recombinant Protein (H00002738-P01).

Blogs on GLI4

There are no specific blogs for GLI4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
GLI4 Antibody
NBP2-14053

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GLI4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GLI4