FOXL2NB Antibody


Western Blot: FOXL2NB Antibody [NBP2-57587] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: FOXL2NB Antibody [NBP2-57587] - Staining of human cell line SiHa shows localization to nucleoli fibrillar center.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

FOXL2NB Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA
Specificity of human FOXL2NB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FOXL2NB Recombinant Protein Antigen (NBP2-57587PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FOXL2NB Antibody

  • C3orf72
  • Chromosome 3 Open Reading Frame 72
  • FLJ43329 Protein
  • FOXL2 Neighbor Protein
  • FOXL2 Neighbor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FOXL2NB Antibody (NBP2-57587) (0)

There are no publications for FOXL2NB Antibody (NBP2-57587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXL2NB Antibody (NBP2-57587) (0)

There are no reviews for FOXL2NB Antibody (NBP2-57587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOXL2NB Antibody (NBP2-57587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for FOXL2NB Antibody (NBP2-57587)

Discover related pathways, diseases and genes to FOXL2NB Antibody (NBP2-57587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FOXL2NB

There are no specific blogs for FOXL2NB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FOXL2NB Antibody and receive a gift card or discount.


Gene Symbol FOXL2NB